PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10000069
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 203aa    MW: 22653.6 Da    PI: 9.5565
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10000069genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.7e-1062120563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR++A rs +RK  +i+eLe kv+ L+ae +aL  ++  l+  +a+l+s++
  Lus10000069  62 KRVKRILANRLSAARSKERKMRYIAELELKVQGLQAEATALSAQVTVLQRDSANLTSQN 120
                  899*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-1758122IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6860123IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.43E-1162118No hitNo description
PfamPF001703.7E-962120IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-1162119No hitNo description
CDDcd147031.03E-1863114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MIMKLPPLGV RVGQHHSPSS SSMQGNLSKF NLEFGNGEFT ELELKKIMSN DKLTELAMAD  60
PKRVKRILAN RLSAARSKER KMRYIAELEL KVQGLQAEAT ALSAQVTVLQ RDSANLTSQN  120
NELKFRLQSI EQQAQLKDAL NEALVAEVQR LRLAASEVGA DSHHHHEQQP QQLPVNHQMI  180
QPGQANTYQQ QQELNQAQNS SN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073848.11e-80PREDICTED: transcription factor VIP1-like
SwissprotQ69IL42e-45RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A067KLE41e-80A0A067KLE4_JATCU; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-68(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-62bZIP family protein